psipred / dmpfold2 Goto Github PK
View Code? Open in Web Editor NEWFast and accurate protein structure prediction
License: GNU General Public License v3.0
Fast and accurate protein structure prediction
License: GNU General Public License v3.0
I got the following error when trying to download BFD_1.3M.hdf5
at https://figshare.com/articles/dataset/Protein_structures_predicted_using_DMPfold2/14979990?file=28893897
{"message": "Storage exception: Unexpected scenario inst_id=549 state=ic_failure", "code": "StorageException”}
It seems the file is incompletely uploaded.
I noticed that input alignments with characters "X" and "N" cause a KeyError at line 202 of the predict.py script. Obviously DMPfold2 is only set up to handle the basic 20 amino acid alphabet.
Do you have any recommendations for how to generate predictions from such alignments without simply removing columns with ambiguous characters?
hey
I have an issue:
Traceback (most recent call last):
File "/home/marcin/anaconda3/envs/dmpfold2/bin/dmpfold", line 5, in
run_dmpfold()
File "/home/marcin/anaconda3/envs/dmpfold2/lib/python3.8/site-packages/dmpfold/predict.py", line 202, in run_dmpfold
atomnum, an, rnamedict[alnmat[0,ri]], ri + 1,
KeyError: 21
Do you know what could be wrong?
I use dmpfold2 on cpu
0: AMD Ryzen 9 3950X
Microarchitectures:
32x Zen 2
<32gb RAM
Hi, dmpfold is really fast! Thanks!
I would like to know if dmpfold has been further evaluated by building side-chain conformations to the output backbone structure?
If yes, which package do you recommend to build side-chain conformations after dmpfold?
Hey again
Another problem... I want to run dmpfold2 on other computer and get this:
(dmpfold) marcin@marcin-Precision-7920-Tower:/mnt/7fee140a-a85e-4bbb-96b1-4a34cdb806c1$ dmpfold -i PF10963.aln -d cuda:0 > fold.pdb
Traceback (most recent call last):
File "/home/marcin/anaconda3/envs/dmpfold/bin/dmpfold", line 5, in
run_dmpfold()
File "/home/marcin/anaconda3/envs/dmpfold/lib/python3.8/site-packages/dmpfold/predict.py", line 184, in run_dmpfold
coords, confs, alnmat = aln_to_coords(args.input_file, device=args.device,
File "/home/marcin/anaconda3/envs/dmpfold/lib/python3.8/site-packages/dmpfold/predict.py", line 128, in aln_to_coords
alnmat = (np.frombuffer(''.join(aln).translate(aa_trans).encode('latin-1'), dtype=np.uint8) - ord('A')).reshape(nseqs,length)
UnicodeEncodeError: 'latin-1' codec can't encode character '\u21b5' in position 102630: ordinal not in range(256)
(dmpfold) marcin@marcin-Precision-7920-Tower:/mnt/7fee140a-a85e-4bbb-96b1-4a34cdb806c1$
do you know what could be wrong?
all best
Marcin
Update
its my fault, bad input
Hi, I was trying to run DMPfold2, but the next error appeared:
Traceback (most recent call last):
File "./dmpfold", line 5, in
run_dmpfold()
File "/home/esgarle/.local/lib/python3.8/site-packages/dmpfold/predict.py", line 175, in run_dmpfold
coords, confs, alnmat = aln_to_coords(args.input_file, device=args.device,
File "/home/esgarle/.local/lib/python3.8/site-packages/dmpfold/predict.py", line 121, in aln_to_coords
alnmat = (np.frombuffer(''.join(aln).translate(aa_trans).encode('latin-1'), dtype=np.uint8) - ord('A')).reshape(nseqs,length)
ValueError: cannot reshape array of size 1977853 into shape (10740,41)
I am not sure if this error is related to the size of the input file, with aln format. It contains around 1500 sequences.
Is there any specification for .aln
format available? Or are there any tools converting from .a3m
format to .aln
?
I did google for .aln
specification, but nothing found. I had tried also using converter from https://github.com/soedinglab/hh-suite/blob/master/scripts/reformat.pl, but non of the output had matched provided example (https://github.com/psipred/DMPfold2/tree/master/dmpfold/example/PF10963.aln).
I did check also online version of HHblits
, but also did not found way to download results in your format. Here is my job:
https://toolkit.tuebingen.mpg.de/jobs/8863800
Sequence I'm looking alignment for is MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVASAAGGNEPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
My a3m file: rcsb_pdb_2GAF_part.a3m.txt
A declarative, efficient, and flexible JavaScript library for building user interfaces.
🖖 Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.
TypeScript is a superset of JavaScript that compiles to clean JavaScript output.
An Open Source Machine Learning Framework for Everyone
The Web framework for perfectionists with deadlines.
A PHP framework for web artisans
Bring data to life with SVG, Canvas and HTML. 📊📈🎉
JavaScript (JS) is a lightweight interpreted programming language with first-class functions.
Some thing interesting about web. New door for the world.
A server is a program made to process requests and deliver data to clients.
Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.
Some thing interesting about visualization, use data art
Some thing interesting about game, make everyone happy.
We are working to build community through open source technology. NB: members must have two-factor auth.
Open source projects and samples from Microsoft.
Google ❤️ Open Source for everyone.
Alibaba Open Source for everyone
Data-Driven Documents codes.
China tencent open source team.