Coder Social home page Coder Social logo

duo's Introduction

Duo

A biological signature based method to batch analyze functional similarities of proteins

Introduction

Duo is a workflow to batch analyze functional similarities of proteins. A key utility provided by Duo is to screen for query proteins with specific characteristics based on highly free and customizable reference protein sequences inputted by users.

Dependencies

  1. python 3.6.9 and following librarires are required:
  1. InterProScan 5 (version 5.47-82.0);
  2. hmmer 3.3;
  3. ps_scan 20.0

Duo workflow

  • Overview of Duo workflow. (A) A schematic to illustrate the general working processes and the three main input contents defined by users. (B) A schematic to illustrate the correction analysis step between Query_proteins/Reference_proteins and Seed_database. (C) A schematic to illustrate the correction analysis step between Query_proteins and Reference_proteins.

Input/Output files description

Input files

  • Query_proteins: query protein sequences file in fasta format

    >unknown_protein_1
    MARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFDIGLRNLDLIMGCERRVVYDF
    VNVIQGDATLNQALIKDKRTENLFILPASQTRDKDALTREGVAKVLDSLKAMDFEFIVCD
    SPAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILASKSRRAENGEEPIKEHLLL
    TRYNPGRVNKGDMLSMEDVLEILRIKLVGVIPEDQSVLRASNQGEPVILDATADAGKAYA
    >unknown_protein_2
    MERITVTLGERSYPITIAAGLFNEPASFLPLKSGDQVMLVTNETLAPLYLDKVRGVLERA
    GVNVDSVILPDGEQYKSLTVLDTVFTALLKKPHGRDTTLVALGGGVIGDLTGFAAASYQR
    GVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPARELAS
    GLAEVIKYGIILDADFFTWLEGNLDALLRLDGPAMAYCIRRCCELKAEVVAADEREAGLR
    ALLNLGHTFGHAIEAEMGYGNWLHGEAVAAGIVMAARASERLGQFSSTDTQRIIALLERA
    GLPVNGPCEMSAQDYLPHMLRDKKVLAGELRLVLPLAIGKSEVRGGVSHEVVLSAIADCQ
    ...
    
  • Reference_proteins: reference protein sequences file in fasta format

    >reference_protein_1
    MSDDMSMGSPSSAGEQGVLRSMQEVAMSSQEASKMLRTYNIAWWGNNYYDVNELGHISVC
    PDPDVPEARVDLAKLVKAREAQGQRLPALFCFPQILQHRLRSINAAFKRARESYGYNGDY
    FLVYPIKVNQHRRVIESLIHSGEPLGLEAGSKAELMAVLAHAGMTRSVIVCNGYKDREYI
    RLALIGEKMGHKVYLVIEKMSEIAIVLEEAERLNVGPRLGVRARLASQGSGKWQSSGGEK
    SKFGLAATQVLQLVETLRDAGRLDSLQLLHFHLGSQMANIRDIATGVRESARFYVELHKL
    GVNIQCFDVGGGLGVDYEGTRSQSDCSVNYGLNEYANNIIWAIGDACEEHGLPHPTMITE
    SGRAVTAHHTVLVSNIIGVERNEYTDPTAPAEDAPRALQNLWETWQEMHKPGTRRSLREW
    LHDSQMDLHDIHIGYSSGAFSLQERAWAEQLYLSMCHEVQKQLDPQNRAHRPIIDELQER
    MADKMYVNFSLFQSMPDAWGIDQLFPVLPLEGLDQVPERRAVLLDITCDSDGAIDHYIDG
    DGIATTMPMPEYDPENPPMLGFFMVGAYQEILGNMHNLFGDTEAVDVFVFPDGSVEVELS
    DEGDTVADMLQYVQLDPKTLLTHFRDQVKQTDLDDALQQQFLEEFEAGLYGYTYLEDE
    >reference_protein_2
    MRRITPFFPFFVLLVSHFSLAISYPLPPEGSRLVGQPVTIAVPQNNTQPLESFAARYGQG
    LSNMLEANPGVDVFLPQSGSTLVVPQQLILPDTVREGIVVNVAEMRLYYYPAGTNTVEVL
    PIGIGQAGRGTPRNWVTAVERKQDGPVWVPTANTRREYAKEGKTLPAMVPAGPDNPMGLY
    AIYIGRLYAIHGTNANFGIGLRVSQGCIRLRNDDIKYLFDHVPVGTRVQIIDRPVKFSVE
    PDGSRWLEVHEPLSRNRAEFESDKKVPLPVTPVLRTFIKGDDVDTSRVNEVLERRSGMPV
    NISAGRPGL
    ...
    
  • Seed_database: protein signatures saved in specific format according the modeling method they applied.

    For example: HMMs profile

HMMER3/f [3.3.1 | Jul 2020]
NAME globins4
LENG 149
ALPH amino
RF no
MM no
CONS yes
CS no
MAP yes
DATE Tue Jul 21 10:15:03 2020
NSEQ 4
EFFN 0.964844
CKSUM 2027839109
STATS LOCAL MSV -9.8664 0.70955
STATS LOCAL VITERBI -10.7223 0.70955
STATS LOCAL FORWARD -4.1641 0.70955
HMM A C D E F G H ... W Y
m->m m->i m->d i->m i->i d->m d->d
COMPO 2.36800 4.52198 2.96929 2.70577 3.20715 3.01836 3.40293 ... 4.55599 3.63079
2.68638 4.42245 2.77499 2.73143 3.46374 2.40505 3.72514 ... 4.58497 3.61523
0.55970 1.87270 1.29132 1.73023 0.19509 0.00000 *
1 1.75819 4.17850 3.77264 3.37715 3.71018 3.31297 4.28273 ... 5.32308 4.09587 9 v - - -
2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 ... 4.58477 3.61503
0.03182 3.85936 4.58171 0.61958 0.77255 0.34183 1.23951
...
149 2.93078 5.12630 3.29219 2.66308 4.49202 3.60568 2.46960 ... 5.42994 4.19803 165 k - - -
2.68634 4.42241 2.77535 2.73098 3.46370 2.40469 3.72510 ... 4.58493 3.61420
0.21295 1.65128 * 1.49930 0.25268 0.00000 *
//
...

Output files

  • domain_correlation.csv: tab-delimited text file, details all the correlation records among Query_proteins, Reference_proteins and Seed_database

    • Example of domain_correlation.csv output from domain_correlation.InterPro.py
   ACC	DB	DESCRIPTION	HIT_PROTEINS(name,domain_num)_R	HIT_PROTEINS_R	HIT_PROTEINS_NUM_R	HIT_PROTEINS(name,domain_num)_Q	HIT_PROTEINS_Q	HIT_PROTEINS_NUM_Q
0	G3DSA:1.10.10.10	GENE3D	<unknown description>	('VFG042447(gb|AAA23662)', 1);('VFG042390(gb|YP_540132)', 1);('VFG042429(gb|CAA54112)', 1);('VFG000880(gb|NP_755468)', 1);('VFG002413(gb|NP_286011)', 1);('VFG042440(gb|AAK16195)', 1);('VFG001713(gb|NP_755457)', 1);('VFG012327(gb|YP_540122)', 1)	VFG042447(gb|AAA23662);VFG042390(gb|YP_540132);VFG042429(gb|CAA54112);VFG000880(gb|NP_755468);VFG002413(gb|NP_286011);VFG042440(gb|AAK16195);VFG001713(gb|NP_755457);VFG012327(gb|YP_540122)	8.0	('STM0960', 1);('STM0068', 1);('STM3876', 1);('STM1547', 1);('STM1805', 1);('STM4588', 1);('STM3682', 2);('STM3888', 1);('STM2920', 1);('STM2145', 1);('STM3014', 1);('STM1127', 1);('STM1950', 1);('STM2275', 1);('STM0115', 1);('STM1625', 1);('STM3533', 1);('STM1887', 1);('STM0347', 1);('STM2557', 1);('STM1523', 1);('STM2131', 1);('STM1894', 1);('STM1842', 1);('STM4270', 1);('STM1659', 1);('STM0466', 1);('STM1520', 1);('PSLT013', 1);('STM3064', 1);('STM0397', 1);('STM0789', 1);('STM3124', 1);('STM2201', 1);('STM1096', 1);('STM3215', 1);('STM1598', 1);('STM3507', 1);('STM0459', 1);('STM3958', 1);('STM2069', 1);('STM3502', 1);('STM0151', 1);('STM1677', 1);('STM2373', 1);('STM4138', 1);('STM2982', 1);('STM2837', 1);('STM0693', 1);('STM2924', 2);('PSLT012', 1);('STM3405', 1);('STM2455', 1);('STM3367', 1);('STM3211', 2);('STM3667', 1);('STM3466', 1);('STM2803', 1);('STM2281', 1);('STM1541', 1);('STM0835', 1);('STM4237', 1);('STM2572', 1);('STM3084', 1);('STM0430', 1);('STM2420', 1);('STM4507', 1);('STM4068', 1);('STM4073', 1);('STM0410', 1);('STM0606', 1);('STM4448', 1);('STM3262', 1);('STM0702', 1);('STM3177', 1);('STM0514', 1);('STM3693', 1);('STM3759', 1);('STM0779', 1);('STM3607', 1);('STM0952', 1);('STM0763', 1);('STM1014', 1);('STM4241', 1);('STM0030', 1);('STM0040', 1);('STM0959', 1);('STM2270', 1);('STM3848', 1);('STM1429', 1);('STM3357', 1);('STM1767', 1);('STM3360', 1);('STM1713', 1);('STM3121', 1);('STM2813', 1);('STM3252', 1);('STM0516', 1);('STM2544', 1);('STM2794', 1);('STM2912', 1);('STM4125', 1);('STM2609', 1);('STM2575', 1);('STM0992', 1);('STM4337', 1);('STM3964', 1);('STM2828', 3);('STM1660', 1);('STM0634', 1);('STM1487', 1);('STM3830', 1);('STM4417', 1);('STM4548', 1);('STM1001', 1);('STM4292', 1);('STM3020', 1);('STM1142', 1);('STM0017', 1);('STM2979', 1);('STM4059', 1);('STM0029', 1);('STM1265', 1);('STM2330', 1);('STM4367', 1);('STM3523', 1);('STM3736', 1);('STM4187', 1);('STM3547', 1);('STM1704', 1);('STM1231', 1);('STM2292', 1);('STM2797', 1);('STM3358', 1);('STM3235', 1);('STM0031', 1);('STM3908', 1);('STM2424', 1);('STM0682', 1);('STM2640', 1);('STM2644', 1);('STM0014', 1);('STM3098', 1);('STM1510', 1);('STM1382', 1);('STM3785', 1);('STM0256', 1);('STM2876', 1);('STM2919', 1);('STM1444', 1);('STM0552', 1);('STM4463', 1);('STM3602', 1);('STM0344', 1);('STM0859', 1);('STM3824', 1);('STM3340', 1);('STM2180', 1);('STM1168', 2);('STM3800', 1);('STM1588', 1);('STM3834', 1);('STM4025', 1);('STM2265', 1);('STM0304', 1);('STM3515', 1);('STM3245', 1);('STM2436', 1);('STM4598', 1);('STM1475', 1);('STM1982', 1);('STM1488', 1);('STM1100', 1);('PSLT041', 1);('STM3897', 1);('STM4511', 1);('STM3606', 1);('STM0764', 1);('STM4314', 1);('STM0333', 1);('STM2785', 1);('STM1387', 1);('STM0692', 1);('STM4402', 1)	STM0960;STM0068;STM3876;STM1547;STM1805;STM4588;STM3682;STM3888;STM2920;STM2145;STM3014;STM1127;STM1950;STM2275;STM0115;STM1625;STM3533;STM1887;STM0347;STM2557;STM1523;STM2131;STM1894;STM1842;STM4270;STM1659;STM0466;STM1520;PSLT013;STM3064;STM0397;STM0789;STM3124;STM2201;STM1096;STM3215;STM1598;STM3507;STM0459;STM3958;STM2069;STM3502;STM0151;STM1677;STM2373;STM4138;STM2982;STM2837;STM0693;STM2924;PSLT012;STM3405;STM2455;STM3367;STM3211;STM3667;STM3466;STM2803;STM2281;STM1541;STM0835;STM4237;STM2572;STM3084;STM0430;STM2420;STM4507;STM4068;STM4073;STM0410;STM0606;STM4448;STM3262;STM0702;STM3177;STM0514;STM3693;STM3759;STM0779;STM3607;STM0952;STM0763;STM1014;STM4241;STM0030;STM0040;STM0959;STM2270;STM3848;STM1429;STM3357;STM1767;STM3360;STM1713;STM3121;STM2813;STM3252;STM0516;STM2544;STM2794;STM2912;STM4125;STM2609;STM2575;STM0992;STM4337;STM3964;STM2828;STM1660;STM0634;STM1487;STM3830;STM4417;STM4548;STM1001;STM4292;STM3020;STM1142;STM0017;STM2979;STM4059;STM0029;STM1265;STM2330;STM4367;STM3523;STM3736;STM4187;STM3547;STM1704;STM1231;STM2292;STM2797;STM3358;STM3235;STM0031;STM3908;STM2424;STM0682;STM2640;STM2644;STM0014;STM3098;STM1510;STM1382;STM3785;STM0256;STM2876;STM2919;STM1444;STM0552;STM4463;STM3602;STM0344;STM0859;STM3824;STM3340;STM2180;STM1168;STM3800;STM1588;STM3834;STM4025;STM2265;STM0304;STM3515;STM3245;STM2436;STM4598;STM1475;STM1982;STM1488;STM1100;PSLT041;STM3897;STM4511;STM3606;STM0764;STM4314;STM0333;STM2785;STM1387;STM0692;STM4402	184.0
1	PF04703	PFAM	FaeA-like protein	('VFG042447(gb|AAA23662)', 1);('VFG042429(gb|CAA54112)', 1);('VFG000880(gb|NP_755468)', 1);('VFG042440(gb|AAK16195)', 1);('VFG012327(gb|YP_540122)', 1)	VFG042447(gb|AAA23662);VFG042429(gb|CAA54112);VFG000880(gb|NP_755468);VFG042440(gb|AAK16195);VFG012327(gb|YP_540122)	5.0	('PSLT013', 1)	PSLT013	1.0
2   ...
Content Name: Explanation

AAC: accession number(id) of the matched biological entity in Seed_database.

DB: the member Seed_database name applied in InterProscan.

DESCRIPTION: the annotation information of the matched biological entity.

HIT_PROTEINS(name,domain_num)_R: records the protein name and the domain number to the matched biological entity in Reference_proteins.

HIT_PROTEINS_R: records the protein name to the matched biological entity in Reference_proteins.

HIT_PROTEINS_NUM_R: count the protein number to the matched biological entity in Reference_proteins.

HIT_PROTEINS(name,domain_num)_Q: records the protein name and the domain number to the matched biological entity in Query_proteins.

HIT_PROTEINS_Q: records the protein name to the matched biological entity in Query_proteins.

HIT_PROTEINS_NUM_Q: count the protein number to the matched biological entity in Query_proteins.
  • domain_correlation_inner.csv: subset of domain_correlation.csv file who only details the correlation records shared between Query_proteins and Reference_proteins.

  • HITPROTEINS: a folder who contains the detailed protein names that correlated between Reference_proteins and Query_proteins.

    • Example of one output file in HITPROTEINS folder (PFAM_HITPROTEINS_Q)
STM1091
STM2897
STM1412
STM0301
STM4572
STM2150
STM3028
STM0175
STM3638
STM0023
PSLT017
...
  • INPUT_BACKUP: a folder who contains the copys of the Query_proteins and Reference_proteins files inputted by user.

Quick Start (run it on Linux system)

domain_correlation_hmmer3.py

  • This is a hmmer3 dependent python script to correlate the proteins (references proteins/query proteins) according the pfam database (or other HMMs_profile)

Usage: pyhont3 domain_correlation_hmmer3.py

--Q_PROTEINS (required=True, type=str, metavar='FILENAME', help="the user selected proteins file as Query_proteins")

--R_PROTEINS (required=True, type=str, metavar='FILENAME', help="the user selected proteins file as Reference_proteins")

--HMMDB_PATH (required=True, type=str, metavar='PATH', help="the path of hmm profile database (Seed_database). eg. /home/fix/downloads/pfam.hmmlib")

--OUTPUT (default="domain_cor_hmmer3", type=str, metavar='directory', help="Output directory name")

--PFAM (action='store_const', const=True, metavar='add --cut_tc option in hmmscan specific for pfam_db', help="optional, specific designed for pfam_db")

--CPU (default=1, type=int, metavar='the cpu num you want to use', help="the cup number you want to use during hmmscan process, default is 1")

--HIT_EVALUE (default=0.001, type=int, metavar='evalue thread', help="the evalue thread use during extracting hmm profile in domain-table, default is 0.001")

--BIT_SCORE (default=10, type=int, metavar='bitscore thread', help="the bitscore thread use during extracting hmm profile in domain-table, default is 10")

domain_correlation_prosite.py

  • This is a ps_scan dependent python script to correlate the proteins (references proteins/query proteins) according the scanProsite database.

Usage: python3 domain_correlation_prosite.py

--Q_PROTEINS (required=True, type=str, metavar='FILENAME', help="the user selected proteins file as Query_proteins")

--R_PROTEINS (required=True, type=str, metavar='FILENAME', help="the user selected proteins file as Reference_proteins")

--PROSITE_DB_PATH (required=True, type=str, metavar='PATH', help="the path of prosite.dat profile (Seed_database). eg. /home/fix/downloads/prosite.dat")

--EVALUATOR_PATH (required=True, type=str, metavar='PATH', help="the path of evaluator.dat profile (for evaluate the pattern). eg. /home/fix/downloads/evaluator.dat")

--ps_scan_PATH (required=True, type=str, metavar='PATH', help="the folder path of ps_scan.pl program. eg. /home/fix/ps_scan/")

--OUTPUT (default="domain_cor_prosite", type=str, metavar='directory', help="Output directory name")

--ONLY_DOM (action='store_const', const=True, metavar='ONLY_DOMMAIN_DB', help="optional,only ps_scan the protein domain profiles")

--ONLY_PAT (action='store_const', const=True, metavar='ONLY_PATTERN_DB', help="optional,only ps_scan the protein pattern profiles")

--SIMPLE_ANN (action='store_const', const=True, metavar='ONLY SHOW THE MATCH ACC', help="optional, in the ouput only show the match profile ID, without detail description")

domain_correlation_InterPro.py

  • This is a InterProScan dependent python script to correlate the proteins (references proteins/query proteins) according the different member databases.

Usage: python3 domain_correlation_InterPro.py

--Q_PROTEINS (required=True, type=str, metavar='FILENAME', help="the user selected proteins file as Query_proteins")

--R_PROTEINS (required=True, type=str, metavar='FILENAME', help="the user selected proteins file as Reference_proteins")

--INTERPROSCAN_BIN (required=True, type=str, metavar='PATH', help="the path of hmm profile InterProScan. eg. /home/fix/export_bin/InterProScan/interproscan-5.46-81.0/interproscan.sh")

--OUTPUT (default="domain_cor_InterPro", type=str, metavar='directory', help="Output directory name")

custom_pfamdb.py

  • This is a hmmer3 dependent python script to constract your own customed pfam profiles database according the proteins you feed to the total pfam databse

Usage: python3 custom_pfamdb.py

--CUSTOM_PROTEINS (required=True, type=str, metavar='FILENAME', help="the user selected proteins file (Reference_proteins) to help construct the custom_pfam databse")

--HMMDB_PATH (required=True, type=str, metavar='PATH', help="the path of hmm profile database. eg. /home/fix/downloads/pfam.hmmlib")

--OUTPUT (default="custom_pfamdb_out", type=str, metavar='directory', help="Output directory name")

--DETAIL_DIC (action='store_const', const=True, metavar='get detailed hmms dictornary', help="optional, get more detailed hmms dictorynary")

--CPU (default=1, type=int, metavar='the cpu num you want to use', help="the cup number you want to use during hmmscan process, default is 1")

--HIT_EVALUE (default=0.001, type=int, metavar='evalue thread', help="the evalue thread use during extracting hmm profile in domain-table, default is 0.001")

--BIT_SCORE (default=10, type=int, metavar='bitscore thread', help="the bitscore thread use during extracting hmm profile in domain-table, default is 10")

Citation

Fei, X., Li, Q., Olsen, J. E., & Jiao, X. (2021). Duo: A Signature Based Method to Batch-Analyze Functional Similarities of Proteins. Frontiers in microbiology, 2308.

Acknowledgments

This study was supported by the National Natural Science Foundation of China (31730094 and 31920103015). XF was supported by funding from the China Scholarship Council (201808320379) and Postgraduate Research &Practice Innovation Program of Jiangsu Province(Yangzhou University)(XKYCX18_102).

duo's People

Contributors

china-fix avatar

Watchers

 avatar

Recommend Projects

  • React photo React

    A declarative, efficient, and flexible JavaScript library for building user interfaces.

  • Vue.js photo Vue.js

    🖖 Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.

  • Typescript photo Typescript

    TypeScript is a superset of JavaScript that compiles to clean JavaScript output.

  • TensorFlow photo TensorFlow

    An Open Source Machine Learning Framework for Everyone

  • Django photo Django

    The Web framework for perfectionists with deadlines.

  • D3 photo D3

    Bring data to life with SVG, Canvas and HTML. 📊📈🎉

Recommend Topics

  • javascript

    JavaScript (JS) is a lightweight interpreted programming language with first-class functions.

  • web

    Some thing interesting about web. New door for the world.

  • server

    A server is a program made to process requests and deliver data to clients.

  • Machine learning

    Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.

  • Game

    Some thing interesting about game, make everyone happy.

Recommend Org

  • Facebook photo Facebook

    We are working to build community through open source technology. NB: members must have two-factor auth.

  • Microsoft photo Microsoft

    Open source projects and samples from Microsoft.

  • Google photo Google

    Google ❤️ Open Source for everyone.

  • D3 photo D3

    Data-Driven Documents codes.