Coder Social home page Coder Social logo

jupyterlab-fasta's Introduction

JupyterLab Fasta Viewer

A JupyterLab extension for viewing Fasta information. A file renderer for files with .fasta extensions and a mime renderer for the application/vnd.fasta.fasta mimetype is included. This extension uses the MSA Fasta viewer.

Screenshot

To use the file viewer, right-click on a .fasta file and choose the Fasta viewer.

To use the notebook viewer, you can define a Fasta display class like:

from IPython.display import display
class Fasta:
    def __init__(self, data):
        self.data = data
    def _ipython_display_(self):
        bundle = {
            'application/vnd.fasta.fasta': self.data,
            'text/plain': self.data
        }
        display(bundle, raw=True)

and then display Fasta('some fasta data')

Fasta(""">SEQUENCE_1
MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEG
LVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHK
IPQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTL
MGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGLEKKTEDFAAEVAAQL
>SEQUENCE_2
SATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEEYLKSQI
ATIGENLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVASKSRDLLRQICMH""")

Prerequisites

  • JupyterLab

Installation

Clone this repo into a directory (say jupyterlab-fasta), and then do

jupyter labextension install ./jupyterlab-fasta

Development

For a development install (requires npm version 4 or later), do the following in the repository directory:

npm install
jupyter labextension link .

To rebuild the package and the JupyterLab app:

npm run build
jupyter lab build

jupyterlab-fasta's People

Contributors

jasongrout avatar blink1073 avatar

Watchers

James Cloos avatar  avatar

Recommend Projects

  • React photo React

    A declarative, efficient, and flexible JavaScript library for building user interfaces.

  • Vue.js photo Vue.js

    ๐Ÿ–– Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.

  • Typescript photo Typescript

    TypeScript is a superset of JavaScript that compiles to clean JavaScript output.

  • TensorFlow photo TensorFlow

    An Open Source Machine Learning Framework for Everyone

  • Django photo Django

    The Web framework for perfectionists with deadlines.

  • D3 photo D3

    Bring data to life with SVG, Canvas and HTML. ๐Ÿ“Š๐Ÿ“ˆ๐ŸŽ‰

Recommend Topics

  • javascript

    JavaScript (JS) is a lightweight interpreted programming language with first-class functions.

  • web

    Some thing interesting about web. New door for the world.

  • server

    A server is a program made to process requests and deliver data to clients.

  • Machine learning

    Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.

  • Game

    Some thing interesting about game, make everyone happy.

Recommend Org

  • Facebook photo Facebook

    We are working to build community through open source technology. NB: members must have two-factor auth.

  • Microsoft photo Microsoft

    Open source projects and samples from Microsoft.

  • Google photo Google

    Google โค๏ธ Open Source for everyone.

  • D3 photo D3

    Data-Driven Documents codes.