Comments (5)
Can confirm short test sequence finished running without a problem: gget alphafold MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/haiku/_src/data_structures.py:37: FutureWarning: jax.tree_structure is deprecated, and will be removed in a future release. Use jax.tree_util.tree_structure instead.
PyTreeDef = type(jax.tree_structure(None))
Thu Aug 18 14:25:21 2022 INFO Validating input sequence(s).
Using the single-chain model.
Thu Aug 18 14:25:21 2022 INFO Finding closest source for reference database.
Jackhmmer search: 100%|██████████████████████████████████████████████████████████| 147/147 [elapsed: 1:02:57 remaining: 00:00]
Thu Aug 18 15:30:35 2022 INFO 58 unique sequences found in uniref90 for sequence 1.
Thu Aug 18 15:30:35 2022 INFO 110 unique sequences found in smallbfd for sequence 1.
Thu Aug 18 15:30:35 2022 INFO 9 unique sequences found in mgnify for sequence 1.
173 unique sequences found in total for sequence 1
Running model_1: 0%| | 0/7 [elapsed: 00:00 remaining: ?]Thu Aug 18 15:30:37 2022 WARNING No GPU/TPU found, falling back to CPU. (Set TF_CPP_MIN_LOG_LEVEL=0 and rerun for more info.)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/haiku/_src/data_structures.py:144: FutureWarning: jax.tree_flatten is deprecated, and will be removed in a future release. Use jax.tree_util.tree_flatten instead.
leaves, treedef = jax.tree_flatten(tree)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/haiku/_src/data_structures.py:145: FutureWarning: jax.tree_unflatten is deprecated, and will be removed in a future release. Use jax.tree_util.tree_unflatten instead.
return jax.tree_unflatten(treedef, leaves)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/haiku/_src/stateful.py:32: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
return jax.tree_map(lambda x: x, bundle)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/modules.py:330: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
ensembled_batch = jax.tree_map(slice_recycle_idx, batch)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/modules.py:335: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
non_ensembled_batch = jax.tree_map(lambda x: x, prev)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/haiku/src/stateful.py:771: FutureWarning: jax.tree_leaves is deprecated, and will be removed in a future release. Use jax.tree_util.tree_leaves instead.
if not jax.tree_leaves(in_axes):
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:50: FutureWarning: jax.tree_flatten is deprecated, and will be removed in a future release. Use jax.tree_util.tree_flatten instead.
values_tree_def = jax.tree_flatten(values)[1]
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:54: FutureWarning: jax.tree_unflatten is deprecated, and will be removed in a future release. Use jax.tree_util.tree_unflatten instead.
return jax.tree_unflatten(values_tree_def, flat_axes)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:128: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
in_sizes = jax.tree_map(maybe_get_size, args, in_axes)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:129: FutureWarning: jax.tree_flatten is deprecated, and will be removed in a future release. Use jax.tree_util.tree_flatten instead.
flat_sizes = jax.tree_flatten(in_sizes)[0]
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:140: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
input_slice = jax.tree_map(
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/quat_affine.py:330: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
rotation = jax.tree_map(expand_fn, rotation)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/quat_affine.py:331: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
translation = jax.tree_map(expand_fn, translation)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/prng.py:48: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
return jax.tree_map(SafeKey, tuple(new_keys))
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:147: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
out_dtypes = jax.tree_map(lambda x: x.dtype, remainder_shape_dtype)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:148: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
out_shapes = jax.tree_map(lambda x: x.shape, remainder_shape_dtype)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:154: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
shard_shapes = jax.tree_map(lambda x: x.shape, regular_shard_shape_dtype)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:161: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
out_shapes = jax.tree_map(make_output_shape, out_axes, shard_shapes,
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:184: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
outputs = jax.tree_map(allocate_buffer, out_dtypes, out_shapes)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/haiku/src/stateful.py:575: FutureWarning: jax.tree_leaves is deprecated, and will be removed in a future release. Use jax.tree_util.tree_leaves instead.
length = jax.tree_leaves(xs)[0].shape[0]
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:173: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
return jax.tree_map(update_slice, outputs, slice_out, out_axes)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/haiku/_src/stateful.py:314: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
params_after = jax.tree_map(
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/haiku/_src/stateful.py:322: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
state_after = jax.tree_map(
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/quat_affine.py:304: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
rotation = jax.tree_map(expand_fn, rotation)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/quat_affine.py:305: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
translation = jax.tree_map(expand_fn, translation)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/all_atom.py:499: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
chi2_frame_to_frame = jax.tree_map(lambda x: x[:, 5], all_frames)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/all_atom.py:500: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
chi3_frame_to_frame = jax.tree_map(lambda x: x[:, 6], all_frames)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/all_atom.py:501: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
chi4_frame_to_frame = jax.tree_map(lambda x: x[:, 7], all_frames)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/all_atom.py:503: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
chi1_frame_to_backb = jax.tree_map(lambda x: x[:, 4], all_frames)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/all_atom.py:516: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
all_frames_to_backb = jax.tree_map(
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/all_atom.py:526: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
jax.tree_map(lambda x: x[:, None], backb_to_global),
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/all_atom.py:554: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
map_atoms_to_global = jax.tree_map(
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/all_atom.py:570: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
pred_positions = jax.tree_map(lambda x: x * mask, pred_positions)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/folding.py:457: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
output = jax.tree_map(lambda *x: jnp.stack(x), *outputs)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/modules.py:319: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
return jax.tree_map(jax.lax.stop_gradient, new_prev)
2022-08-18 15:37:35.147327: E external/org_tensorflow/tensorflow/compiler/xla/service/slow_operation_alarm.cc:65]
[Compiling module jit_apply_fn.5] Very slow compile? If you want to file a bug, run with envvar XLA_FLAGS=--xla_dump_to=/tmp/foo and attach the results.
2022-08-18 15:42:51.437904: E external/org_tensorflow/tensorflow/compiler/xla/service/slow_operation_alarm.cc:133] The operation took 7m16.29072564s
[Compiling module jit_apply_fn.5] Very slow compile? If you want to file a bug, run with envvar XLA_FLAGS=--xla_dump_to=/tmp/foo and attach the results.
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/model.py:172: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
jax.tree_map(lambda x: x.block_until_ready(), result)
Running model_2: 14%|█████████ | 1/7 [elapsed: 24:58 remaining: 2:29:51]2022-08-18 16:08:09.881534: E external/org_tensorflow/tensorflow/compiler/xla/service/slow_operation_alarm.cc:133] The operation took 7m29.936369231s
[Compiling module jit_apply_fn.7] Very slow compile? If you want to file a bug, run with envvar XLA_FLAGS=--xla_dump_to=/tmp/foo and attach the results.
Running model_3: 29%|██████████████████ | 2/7 [elapsed: 49:08 remaining: 2:02:28]2022-08-18 16:29:46.228967: E external/org_tensorflow/tensorflow/compiler/xla/service/slow_operation_alarm.cc:133] The operation took 6m40.557215143s
[Compiling module jit_apply_fn.8] Very slow compile? If you want to file a bug, run with envvar XLA_FLAGS=--xla_dump_to=/tmp/foo and attach the results.
Running model_4: 43%|██████████████████████████▏ | 3/7 [elapsed: 1:12:02 remaining: 1:35:05]2022-08-18 16:47:57.276966: E external/org_tensorflow/tensorflow/compiler/xla/service/slow_operation_alarm.cc:65]
[Compiling module jit_apply_fn.9] Very slow compile? If you want to file a bug, run with envvar XLA_FLAGS=--xla_dump_to=/tmp/foo and attach the results.
2022-08-18 16:53:06.778986: E external/org_tensorflow/tensorflow/compiler/xla/service/slow_operation_alarm.cc:133] The operation took 7m9.502119733s
[Compiling module jit_apply_fn.9] Very slow compile? If you want to file a bug, run with envvar XLA_FLAGS=--xla_dump_to=/tmp/foo and attach the results.
Running model_5: 57%|██████████████████████████████████▊ | 4/7 [elapsed: 1:35:56 remaining: 1:11:28]2022-08-18 17:17:07.760154: E external/org_tensorflow/tensorflow/compiler/xla/service/slow_operation_alarm.cc:133] The operation took 7m11.676369326s
[Compiling module jit_apply_fn.10] Very slow compile? If you want to file a bug, run with envvar XLA_FLAGS=--xla_dump_to=/tmp/foo and attach the results.
Running model_2_ptm: 71%|██████████████████████████████████████████▏ | 5/7 [elapsed: 1:57:52 remaining: 46:16]2022-08-18 17:35:49.388007: E external/org_tensorflow/tensorflow/compiler/xla/service/slow_operation_alarm.cc:65]
[Compiling module jit_apply_fn.11] Very slow compile? If you want to file a bug, run with envvar XLA_FLAGS=--xla_dump_to=/tmp/foo and attach the results.
2022-08-18 17:42:01.516711: E external/org_tensorflow/tensorflow/compiler/xla/service/slow_operation_alarm.cc:133] The operation took 8m12.12882662s
[Compiling module jit_apply_fn.11] Very slow compile? If you want to file a bug, run with envvar XLA_FLAGS=--xla_dump_to=/tmp/foo and attach the results.
Running model_2_ptm: 86%|██████████████████████████████████████████████████▌ | 6/7 [elapsed: 2:23:14 remaining: 23:53]Thu Aug 18 17:53:49 2022 WARNING
Running model without relaxation stage. Use flag [--relax] ('relax=True') to include AMBER relaxation.
Running model_2_ptm: 100%|███████████████████████████████████████████████████████████| 7/7 [elapsed: 2:23:23 remaining: 00:00]
from gget.
Hi, I am having trouble reproducing this error. Jackhmmer will create a "tmp" folder in your home directory where it will temporarily store downloaded database chunks and then delete them. It looks like one of the database chunks was already deleted before the 'os.remove()' command. I am not sure how this happened. Does it happen every time you run alphafold?
from gget.
Yes this repeatedly happens. Could it be a property of the VM?
from gget.
Do you think it could be because the AA input is too big? I am trying your test sequence from example, and it is running, but very slowly:
gget alphafold MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/haiku/_src/data_structures.py:37: FutureWarning: jax.tree_structure is deprecated, and will be removed in a future release. Use jax.tree_util.tree_structure instead.
PyTreeDef = type(jax.tree_structure(None))
Thu Aug 18 14:25:21 2022 INFO Validating input sequence(s).
Using the single-chain model.
Thu Aug 18 14:25:21 2022 INFO Finding closest source for reference database.
Jackhmmer search: 100%|██████████████████████████████████████████████████████████| 147/147 [elapsed: 1:02:57 remaining: 00:00]
Thu Aug 18 15:30:35 2022 INFO 58 unique sequences found in uniref90 for sequence 1.
Thu Aug 18 15:30:35 2022 INFO 110 unique sequences found in smallbfd for sequence 1.
Thu Aug 18 15:30:35 2022 INFO 9 unique sequences found in mgnify for sequence 1.
173 unique sequences found in total for sequence 1
Running model_1: 0%| | 0/7 [elapsed: 00:00 remaining: ?]Thu Aug 18 15:30:37 2022 WARNING No GPU/TPU found, falling back to CPU. (Set TF_CPP_MIN_LOG_LEVEL=0 and rerun for more info.)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/haiku/_src/data_structures.py:144: FutureWarning: jax.tree_flatten is deprecated, and will be removed in a future release. Use jax.tree_util.tree_flatten instead.
leaves, treedef = jax.tree_flatten(tree)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/haiku/_src/data_structures.py:145: FutureWarning: jax.tree_unflatten is deprecated, and will be removed in a future release. Use jax.tree_util.tree_unflatten instead.
return jax.tree_unflatten(treedef, leaves)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/haiku/_src/stateful.py:32: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
return jax.tree_map(lambda x: x, bundle)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/modules.py:330: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
ensembled_batch = jax.tree_map(slice_recycle_idx, batch)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/modules.py:335: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
non_ensembled_batch = jax.tree_map(lambda x: x, prev)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/haiku/src/stateful.py:771: FutureWarning: jax.tree_leaves is deprecated, and will be removed in a future release. Use jax.tree_util.tree_leaves instead.
if not jax.tree_leaves(in_axes):
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:50: FutureWarning: jax.tree_flatten is deprecated, and will be removed in a future release. Use jax.tree_util.tree_flatten instead.
values_tree_def = jax.tree_flatten(values)[1]
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:54: FutureWarning: jax.tree_unflatten is deprecated, and will be removed in a future release. Use jax.tree_util.tree_unflatten instead.
return jax.tree_unflatten(values_tree_def, flat_axes)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:128: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
in_sizes = jax.tree_map(maybe_get_size, args, in_axes)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:129: FutureWarning: jax.tree_flatten is deprecated, and will be removed in a future release. Use jax.tree_util.tree_flatten instead.
flat_sizes = jax.tree_flatten(in_sizes)[0]
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:140: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
input_slice = jax.tree_map(
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/quat_affine.py:330: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
rotation = jax.tree_map(expand_fn, rotation)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/quat_affine.py:331: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
translation = jax.tree_map(expand_fn, translation)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/prng.py:48: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
return jax.tree_map(SafeKey, tuple(new_keys))
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:147: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
out_dtypes = jax.tree_map(lambda x: x.dtype, remainder_shape_dtype)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:148: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
out_shapes = jax.tree_map(lambda x: x.shape, remainder_shape_dtype)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:154: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
shard_shapes = jax.tree_map(lambda x: x.shape, regular_shard_shape_dtype)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:161: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
out_shapes = jax.tree_map(make_output_shape, out_axes, shard_shapes,
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:184: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
outputs = jax.tree_map(allocate_buffer, out_dtypes, out_shapes)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/haiku/src/stateful.py:575: FutureWarning: jax.tree_leaves is deprecated, and will be removed in a future release. Use jax.tree_util.tree_leaves instead.
length = jax.tree_leaves(xs)[0].shape[0]
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/mapping.py:173: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
return jax.tree_map(update_slice, outputs, slice_out, out_axes)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/haiku/_src/stateful.py:314: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
params_after = jax.tree_map(
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/haiku/_src/stateful.py:322: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
state_after = jax.tree_map(
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/quat_affine.py:304: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
rotation = jax.tree_map(expand_fn, rotation)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/quat_affine.py:305: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
translation = jax.tree_map(expand_fn, translation)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/all_atom.py:499: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
chi2_frame_to_frame = jax.tree_map(lambda x: x[:, 5], all_frames)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/all_atom.py:500: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
chi3_frame_to_frame = jax.tree_map(lambda x: x[:, 6], all_frames)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/all_atom.py:501: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
chi4_frame_to_frame = jax.tree_map(lambda x: x[:, 7], all_frames)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/all_atom.py:503: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
chi1_frame_to_backb = jax.tree_map(lambda x: x[:, 4], all_frames)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/all_atom.py:516: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
all_frames_to_backb = jax.tree_map(
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/all_atom.py:526: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
jax.tree_map(lambda x: x[:, None], backb_to_global),
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/all_atom.py:554: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
map_atoms_to_global = jax.tree_map(
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/all_atom.py:570: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
pred_positions = jax.tree_map(lambda x: x * mask, pred_positions)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/folding.py:457: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
output = jax.tree_map(lambda *x: jnp.stack(x), *outputs)
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/modules.py:319: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
return jax.tree_map(jax.lax.stop_gradient, new_prev)
2022-08-18 15:37:35.147327: E external/org_tensorflow/tensorflow/compiler/xla/service/slow_operation_alarm.cc:65]
[Compiling module jit_apply_fn.5] Very slow compile? If you want to file a bug, run with envvar XLA_FLAGS=--xla_dump_to=/tmp/foo and attach the results.
2022-08-18 15:42:51.437904: E external/org_tensorflow/tensorflow/compiler/xla/service/slow_operation_alarm.cc:133] The operation took 7m16.29072564s
[Compiling module jit_apply_fn.5] Very slow compile? If you want to file a bug, run with envvar XLA_FLAGS=--xla_dump_to=/tmp/foo and attach the results.
/home/ccadmin/anaconda3/envs/gget/lib/python3.9/site-packages/alphafold/model/model.py:172: FutureWarning: jax.tree_map is deprecated, and will be removed in a future release. Use jax.tree_util.tree_map instead.
jax.tree_map(lambda x: x.block_until_ready(), result)
Running model_2: 14%|█████████ | 1/7 [elapsed: 24:58 remaining: 2:29:51]2022-08-18 16:08:09.881534: E external/org_tensorflow/tensorflow/compiler/xla/service/slow_operation_alarm.cc:133] The operation took 7m29.936369231s
[Compiling module jit_apply_fn.7] Very slow compile? If you want to file a bug, run with envvar XLA_FLAGS=--xla_dump_to=/tmp/foo and attach the results.
Running model_3: 29%|██████████████████ | 2/7 [elapsed: 49:08 remaining: 2:02:28]
from gget.
Could you please send me the sequence that caused a problem before?
from gget.
Related Issues (20)
- Rewrite gget BLAST to use BLAST+ instead of deprecated NCBI server
- Invalid command line Expected -option_name or --option_name, got '-' using gget muscle HOT 6
- Request addition of Open Targets API
- Multiple sequence alignment for multiple species HOT 10
- gget seq encounters missing gene name from uniprot and throws type error HOT 2
- gget.cellxgene TileDBError error when trying to return anndata HOT 4
- Add module to COSMIC database
- Add module for reactome
- KeyError: 'Primary_Acc' HOT 3
- Module to download MitoCarta3 database
- Is it possible to get all ELM's using gget? HOT 4
- Add module to depmap database HOT 1
- Issue finding ensembl database for homo_sapiens release 112 37 HOT 3
- Add module to collect data from Genomics 2 Proteins portal
- Hello thanks for the wonderful package. Can you please add support for this https://www.gsea-msigdb.org/gsea/msigdb/ Especially for getting gene sets
- Specify an output folder for downloaded reference with gget ref
- Bgee module
- ENCODE downloader HOT 2
- expand gget search to include synonym hits in addition to name and description hits HOT 4
- gget pdb error in python HOT 3
Recommend Projects
-
React
A declarative, efficient, and flexible JavaScript library for building user interfaces.
-
Vue.js
🖖 Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.
-
Typescript
TypeScript is a superset of JavaScript that compiles to clean JavaScript output.
-
TensorFlow
An Open Source Machine Learning Framework for Everyone
-
Django
The Web framework for perfectionists with deadlines.
-
Laravel
A PHP framework for web artisans
-
D3
Bring data to life with SVG, Canvas and HTML. 📊📈🎉
-
Recommend Topics
-
javascript
JavaScript (JS) is a lightweight interpreted programming language with first-class functions.
-
web
Some thing interesting about web. New door for the world.
-
server
A server is a program made to process requests and deliver data to clients.
-
Machine learning
Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.
-
Visualization
Some thing interesting about visualization, use data art
-
Game
Some thing interesting about game, make everyone happy.
Recommend Org
-
Facebook
We are working to build community through open source technology. NB: members must have two-factor auth.
-
Microsoft
Open source projects and samples from Microsoft.
-
Google
Google ❤️ Open Source for everyone.
-
Alibaba
Alibaba Open Source for everyone
-
D3
Data-Driven Documents codes.
-
Tencent
China tencent open source team.
from gget.